PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00068576001
Common NameGSBRNA2T00068576001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 318aa    MW: 35908.4 Da    PI: 4.946
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00068576001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32150204155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k r+rWtpeLHe+Fveav++LGG ++A Pk++l++mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00068576001 150 KGRMRWTPELHEAFVEAVNHLGGMNNAKPKAVLKHMKVQGLTIYHVKSHLQKYRT 204
                          56****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.134147207IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-29149205IPR009057Homeodomain-like
SuperFamilySSF466891.54E-17149204IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-23150204IPR006447Myb domain, plants
PfamPF002491.2E-10152203IPR001005SANT/Myb domain
PfamPF143791.2E-21236280IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
METRNLAHTC SSIPPPDIPF NSQQHNHLLS EAAGHIYSND LPSTDTPFIP EILDWDHDLL  60
DLPLDFSPIQ MEEEEEDGGI LPSDENPIMS PYWNDLILDT SSTSASKLVH ESTMQPQVPL  120
QQPPSPCVEL PPLVRTVSSN SNDNTSAAAK GRMRWTPELH EAFVEAVNHL GGMNNAKPKA  180
VLKHMKVQGL TIYHVKSHLQ KYRTARYVPE PSQGSQETKL TPLEHVTSLD TKRGIDITEA  240
LRIQMEVQKQ LHEQLEVQRK MQLRIEEQGK VLLMMFEKQN MDFCKPDQED KASEKTTPES  300
CSEEADSPRP KRPRNNE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.243480.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00068576001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660150.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A078HML70.0A0A078HML7_BRANA; BnaA09g10270D protein
STRINGBra036679.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20400.15e-95G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]